TCDB is operated by the Saier Lab Bioinformatics Group
>KKT29371.1 hypothetical protein UW16_C0030G0015 [Microgenomates group bacterium GW2011_GWC1_44_10]
MQQEKRTMKRALPYLFVTLIFATILNLSRASYSFINTHDEDDNIVSGFLMSRNNLQMSKEIFTHHLPGAYLISEVLDRTF
QPTGTDQSVYVHRTFITIWNYVWAVVLVSVWGPFSVWLVLVVELLRASYLHGLFQAENLVIYPMVYLLLTFVTKRKTHPL
LSGFSTGLIAVLLSPLWPLILSTSCRFLWFNRLKPKYIVLWLVAFLIPVVWTLVKIDVRGFATQFFGYNVQTYAPLLINN
PVKYTLKVFLAPALVMKNLSLTTKNISIQLLVLFLFIFDFKRIKFRTLIIFGLLLGMIGYRSVPGLNNVLDFHALPWVAA
LGALCWYKYFGAIRQKGFLWNLVLLVPLFMFLMNPSDYFPNQKQAGKMVIRYADKSPVVNYLNSIKATGDTLFTLPAHTL
LYQQTNIIPFNKFLFYLPWMEQSPILYTELVDSFQDRLPTFLFIDKIHFPYFPPDEISKLLKNYEEVKIVENEPPVYILN
NYQFSITK