TCDB is operated by the Saier Lab Bioinformatics Group
>KKW03249.1 Membrane transport protein [Candidatus Beckwithbacteria bacterium GW2011_GWC2_49_11]
MNPKTKGTAWILNSAVFFATYGVWSHLMGHDFGEFSQAWTRGLILLVFVVLVGKWKKLFKPMPKKDWPWFLVIASIGLNQ
APYYYGFQHLGVGTATLLFYAALVIGGYLIGKLVFNETLTRTKLTSLVIGLAGLGVIYRLSLTPAQIWPATLTIIAGLMG
AISAVLPKKLSGQYHEFQIMAGYLTVMLVANGLIAYLVKDSLPPISAHSAWLAAAAYAAALLIANFSVIEGFKYLEASIG
SLIGMAEIIFGILFGFLFFGEILSATTFLGGALIVLAAALPNLKLPPSLWESRGPKQNNK