TCDB is operated by the Saier Lab Bioinformatics Group
>KNE54626.1 hypothetical protein AMAG_00589 [Allomyces macrogynus ATCC 38327]
MVDSRRGSDTNTGAARRPSDPSAGAPRRGSAGSGATAGPATARTTATTTTAAAPAGHEQHAHGHAHAHANARLHRANPED
KVVISVYPPDTPTPPPLQAMPQPVDPTRLQSPPGSPNTTASPGPSRIAQARGRPGPMPLTSASSVQSRRSSGVASNASPA
RLSPIIAFPEPQPVSPLVMPSPQPPPSPGFYQPAVSGSSYSIAPGIYPPPSPGVYPPPSPVYPPPASPGYPPPAPSGYPL
TTFSPYPPTGSSAVPSSAGASVVMPMPTPTVPITPTAVPSGASTVMPMPTPTAPGAQTVVSGSASVVMPMPTPTTPTSPT
AASVASQSTTGLALPTSSIALYPPSPGIAPVSPGSAQFPMPSPGFGPVSPGIPVIPTTPYPPATPPKSPATRPTIPLATP
SSAGVSSSGPFLPSPASAQSPYGDYPLGRRPSSNGSHMGRRPSSTPSHGVVPPSPLGPNFPSPSLAPAVPPKPMVVSLDT
LPASISTSAAGIEVDPTRLADQAANEHVRELVPLMVTEQELKERYGVGIQRYYKFIRFIVGANLFLALFGLVVWLPHVMA
SETSNFFGGLFTISFGSQFTSFWRGAGITQCVLWFLLPGAYLLLFRADPDAERETEHYDTEENIIPQNRNVPFYQLVMRR
TFTSTVFVLMVIGSYLLTETLQNISTRNREAEKNEPGGGSSSGTLRLMDWGISMALTMINFASAFVINQLTVFDRFKTRD
HTWKAAIIKLFLFRVIGVIAFYQAIYQADPCSGGVKFFTLLISDLLLGNAFEIFAPQVITWVKFPWANVNTKSDEENKPE
FDVAAEYVELLYRQYIIYLGSSQFPMVALLGAIVSGSEYLVDKYRMLRVCQEPKVVNRTLRVPLAVMLLVTAIFGLVGSE
FAPAFVYSRTSMLPLMTKGGQQTCWQLYGGAAPL