TCDB is operated by the Saier Lab Bioinformatics Group
>KNE65670.1 hypothetical protein AMAG_09653 [Allomyces macrogynus ATCC 38327]
MTALSLIGNALISLGPAVVLFALFLARRPSLFLLALTSSFFALVALLFSSLIWYALPGRAESLQFGYESPVGTQAIAIVI
AVLSQELVRWGSWFLIRRAEGGIMLASEFPRSPFHRFSMSAAFGYGYGLLVVLIMHITPLIESAGPGIRPAKSCPGVPDV
LLASLLMMFQFLHHIAWTILLFHGMFSTVPPLTFPASGSTTNLSDQATAPAAARGAPSRGPGKWALVAYVLVSHMGVSMT
SLMQSMPSIVGCIAPLVVSGAVLAVSGYLVWGVVEATVKKAS