TCDB is operated by the Saier Lab Bioinformatics Group
>KXZ49351.1 hypothetical protein GPECTOR_22g945 [Gonium pectorale]
MTIDFFGLLFLGLGPGVAFFLVLLARKSFLVLLALFSAFIWLVVLLFISAIFRGFVPIKVLEGPYAGVLAASVVIQEAVR
CGIWLLHRKTVQVLEGMARSSGHRFSALDKLYMATAWGYGHAACHAVFFFLSLLSLTTSDGTFYIDACPQMSIFLVGALY
VLSFGLILTCLMVIFFDGFQSKTTAHIVAAPVLHMAAAMTTLLNFKGSGCVYAMPFLLAAGVLLTIYTTLGGTDAVAAAV
SSKQQHLKLKHRPEDRTSHPIYGERVEGARLLLRIARTRQGAAQDGEPAGNDGGTPSPMDADEAQDGAITVEDAGEGAVT
ASIVARVPQTFRFPGLADFAFIPHDPLLEHRKRDALPYDQRPDRAEPTKAMQPFLLIPQLFSWLDLPQDYAFRQLPSKQL
PRAAGAAEPSWGDAPIISFYADGVPPPAPAAAAAAAPVAGEQAAAAAAAAAALESGDGAGVDGAAAYRALEAEVARLLAQ
RPVWGLELMRERCAASAAVAAAMPGGGCDAAAVERVLQRLCYRFKTGPWRGLFIRRGFDPRSDVEARKYQAIVYTLPNNW
YRKMLRSGPQPAHPAAAPRRAGQPDGAEGADRAQEGAAGALAPSSMDELHNFRALPTTASTTLQLLDLQLPEVQAVLQEA
PPADDGARCSEKTGWFTNAVLQQMQNAVQQRFAQLMDRLAHPGAAGGATGAEAAGAGRGAAASAAPRGRAANAGSGAGGG
SRARPSNGRAAAAGGSGDVEMADANAGTGAAPPSGTGVAAPPAAGSADDALRALMEQMNLRSLAAGGGAGGVAGLFGDDD
DDEFRLLDEQGDEEAEATGTRGSVGGRAGRMARGVGDDGRAAGGAGGLGPARGGAAAAVGRSQGGDVDVSDGDESAMESE
YDVVTEEDEEDEGEEDELARAGPSRSSAGGGANARKDDDDLGGLFGTSDEDY