TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1JIL2|L1JIL2_GUITH Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_162455 PE=4 SV=1
MEGRNVNLNEFVEIEEPEVWSGPHAATSRGQGGSLRLRGAPFLEDSGEEKLTNIIPGQVSSSETEFVEESAPDLQLIEPK
FGSFIPLEEFQEAVEDDLGGNYDELWKKDASEEKKKSFVPPVEFKTVVEDDIPDDDGARFGTEKDARRNQNRLDLQDVEK
RLSRVDAAVSTLAKELAEQEEINQKLKKQLKRLRTDKVELEERLEDWNVQTQERGLVKASNAAEEKKFREVEARIKREEA
RRRAMELGLEYEQEDDMTQSTALGIMKLLRIRLRAFKTSLRQHDILYRQSRAAESRFGSGVSLYFWFYRWILQTTMWTVI
LLWLFVFIFHFIRYLSTRSFKMISIYPQFFFFSTVDTSMSTIYASFLFASVGSIVLLASYKVTVEYGKMFDIEVQNWGKE
PQRYAKLAFTAWDWAIADDSAAQDMKDAISQNFRILKFEDELADRIRNRSQQEWTRLYVKRSVSLFFNFIALAGGWSTII
VSKFILFTGRVNNSSGLTGQLLALVPNIIPSAVNGIMPQVVDFCVDFEEWDDPAFVLKMRVSRLYAAKILNALIQVALVF
ILFHGADNLGLQRVLLRSCSYLTCEDQAGSTFFALFYTDVIINMATAYGFAVGFHFLYTKILNKPSLAKDEFRPSAQIIK
VLYQQIFLWLSLPHFPFAIFIGFILWFLQFQVDSYILFNYNAKPVRPFDVKDGGVYFALFYSFTLFLFLGWFYYVWFIFS
SSTSDLLCCRLTELVASGNGTSGACFAVNITASTCLSDALKTNSVAESASTNYLFYSSSPASVVAADIQSNLFFSPLLQA
VQTPLLAWFLVSLILVLFFAERSYVQVLEKYKEEKINELNLQQTMLQRQIRGKERRISFAGSTIQ