TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1JSU5|L1JSU5_GUITH Uncharacterized protein OS=Guillardia theta CCMP2712 OX=905079 GN=GUITHDRAFT_134531 PE=4 SV=1
MMHSLSHWISRDYFLGRPIDDILSYRTTKIVRVQDRLVGLADILIKTLVIAFVVAVLLIKYGGFLEKEPISGSVNFVLLG
GFHGLNYTDLPYCAEFPCKFADVYTISQSNLHDRFILIATMIQERSQTRRCSETDDVCDHDSPFKAQDMSSYYAAGVEDF
TLTIHHEAVAPTFWSEDRVDRYRGSSEQMKGKLVSYRDDGTGRMATLTLAEFNTGNAVRMSIKDVVAAANLDIDAPLPDE
TSPVRNTGVELDCYIRYSNTWSWFPPAPELRYEMEFVMAKKQLSWMSSAYQAVGFGDARMLVKRTGIRINFHQSGMIARF
SIVELFKTLGAGVLLWLLSSWLMDQFITRYAPLSERYEAGKYEFTENIYNLRVCQNEMNDQITEPEGDVLERLRTDSLK