TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8GZA7|L8GZA7_ACACA Uncharacterized protein OS=Acanthamoeba castellanii str. Neff GN=ACA1_061830 PE=4 SV=1
MAEGDEQKKFEITLWYAPTKKPVNNPLLLSFWKSLVAWIPQAFIYSDKRIWKEKGADAIMHIRFLRICLLLCGMMALFGS
AVIIPINIHGTTTEQLPDLGYLTISNIDGTDTKLIAHVLFTYFYSFVSYFIIWFYYRKYTDLRKKYLNKNEVKGYSIILR
NLPTRLRDNQSLRQWFEDHFDGVKVISVRLVWNDKKLRKLRKKRVRYLNKLEMAEQDLEEFDKFKRQWNNKLTELKRKRE
LREWENSRDHTHVMEVHHPQSPAQGKTDSGGSSSSERTHNDNDISGAMTRGEGKHHNGELLTTSGHLRATMRESNFILTL
SGGRLSYDTLPDELEMETRPSKHSGLEGGGGDKGRDVEGGGGGPLADPEERRRRKSCCFWFLYEWRKWKWKMKNRTILKH
CMGDLKRNSDNVPKRLAHLIDEEIASIRYLKAKIAKLTSHISAIQANPEKHLPKTGVAFMVFDSMVVPRMTIQPFVAPHE
MIISAAPEPNDVSWKTLHPPYWRLLLTRTVVIVGLTLMAIAWAFPAFIFASLANLQSLSEVDGFGWIQTGISDHLSDYAV
SVVEGFAPAIFLVLSLVLAKHIIRWIIHRSYEWAKSTVEWKTMTTYWSFLIIHVVFVSTFGGTLSKILSEFIDNPRNLIS
LLAQALPQNSTFFINYILVVTFCITPLTLFRTRQILQQFVWYVLMRPSTVRQKAKMWQYPTFDYAGSVAQGLLIYTVTLV
YSLMAPLISVFGLCYFIVVYLVDRYQIIYTTRTSWQGGATMWPLIFHMFMTSLILFQLAMIGILTLSKFGGGGALVALPF
ITAGIWVLLHFHWVTVSNSGPINGVSTLKPLSYEEFRKAYTQPSMLAVEQEDANYAKRAATSTTDSSYDRDAYSNDFSDD
DEDFEQEQERTETEQDDSDDDDDDDDDDDGIDDSYDSPAEEKKTAVRGGGAPRTLQQRRPAAAPTQRHAASSGDGYDYDF
SEDSDDTTEPTSPNYFHV