TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L9XT14|L9XT14_9EURY Uncharacterized protein OS=Natrinema versiforme JCM 10478 GN=C489_16056 PE=4 SV=1
MVSTAILFALGALLLYGGWAVAGGVATRSLSPVNAVFLSYVASIVIAGGYVLSLRRPISGTRVDIAFALVSGTFLAAASI
CFYAGLARGNMAIVSAISALYFVIPAVVGVLYFEAQLSPTNVAGLALAVIAVGLVAT