TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M0J8Z5|M0J8Z5_HALVA Uncharacterized protein OS=Haloarcula vallismortis ATCC 29715 GN=C437_13000 PE=4 SV=1
MNAAVLFGLGTMIAWGFWIAFGNVASSTMDPETAAFVSYAAATVVTGLYVAVSDASLVVTNRGLLFAGAAGVAAAVGVVS
TFVGVTVGSTSVVSTIGGMYFITAAVIGVIAFGESMTLTKAAGIGLALTAIVVINQ