TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M1V6H9|M1V6H9_CYAME Similar to chloroplast inner membrane protein Tic110 OS=Cyanidioschyzon merolae strain 10D GN=CYME_CMQ342C PE=4 SV=1
MQSPAEALSQQHAQGWHFTRGPFAVLGFVNLFPAGAGSNFATRNLLRKGRCSKQQLRGKRWCCVRGFRVERQSLQAAAEV
PTPYRFALGRAPVERAKAAGPISQQHARSEEELNELVAKRFLELVRSEGTGPVGVPAQLVKPAWLEWSDRMATRLAGLGQ
VWRVLFSVLLAATIGAAAAGVTPPGRRRAAGFAAGALPTAALAVVMLRRGRSIGAPRALASALVESTVAVSTKNMPSASD
DQRRRADDNGGEDTESDDNGATSSNAPPRLGLASHIDPEMIQRVAIQYGMQPDAPSWKLETLVGLYERYLLALVQTSGTP
RVSEVRQLKALRSAFGLSHVDVGDAHHQVAMRFRRENFVYIDDYIRAQDVDDRNYDEIFRERAQDVNQKLSKLLFLSARV
LDDPTEPEEAYRYEMARLRNVFDLSESEFQARVRDIAVPFYQTAVRKAVWLLEQGRSITLEKLRSAREMLDVDDGTASRL
HLEAYGALVQRLLQAHSNEKVPRLSAKDMSVLQEARRLLDIDAGDADALLRDAAEPLYQQEVERVVESADLRIPTAHGRL
AVRREELGLSVELARTAAEKWIRGRVTAILKDATRALRVQNLTMTIEELNRLLGLIRRSLSIIHGVVWEEVVPNSAEQRT
VNASLERIMSVLLDELADLERQQLYRVYLAKCLEDRMIDAQEGRNLDDLRAVLRISENEAAQAYNRAAGPVYREAVLEVM
ANRSEFTDADIQSLNQIAGDLHIPAKVAHDIRMELYRERLEASTRDNRVPSEEESSQLARLRELLQLDSEALAALHASVC
AGTYAQSVDECMGSNGIIPEPYRAGLERLRQRLCLDERRARELFLQVARRRMAGYVQRAIKLLQKKQSFRGQDEERDVGD
DPFVRRAGAFLGIEAGTITIELSNLIDFYIRNGILEMENEQAVYPVNLRGVFDLNILQEMYRQYLIQSFAAKSRTEKERL
FNNLAHLGNILGLTSAEVNAIHSNIGSVIYKTYASQALTNNRLEEKDIEFLRNIQNMLSMDEATCRTLLQETKEARAGFL
FDKIFSRTFGMAEAVAEFRRVCRELDVDPVRDLKLTEDRRVRAFRAEIEHAIENGLITPENQSLLKESQEELGISAEKAR
QVLLDCIQDRCEALIVQAAASLRQRRQEGAARDLSRALRFGKLLPFQVQTPTVTGAERQELYLVYQAYALGTARSNAEND
QVKEDLALLREMLGIQAA