TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M2W844|M2W844_GALSU Uncharacterized protein OS=Galdieria sulphuraria GN=Gasu_07770 PE=4 SV=1
MFPFLVFCHVLQVILKLDQLPGFAQQYWLKTYVVSFCVAFGGSTIAHILCGKVVPWLSFPNDRLVATTFVAWWLVHCLPW
FHLVSRWSLVRATIAGLAAVAKARSIMQFIDDVHKWFPIGGGVLGNVVLGTIAGCGGNLFLIVEEKWRVGSTCSVSELSR
PTHNLKSAFCISLIYTVARRKRWQYGNYLSLQWEPWLPLSRVYKCICLFMFVHSWVEEYTGCVHLFGLLLSPIEQMACSL
FRIRVTVDPRTTSSVATVHEVVDSTSTSSMKTTSALAYVKQYSPMKGKTS