TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M3E394|M3E394_9ACTO Uncharacterized protein OS=Streptomyces gancidicus BKS 13-15 GN=H114_14501 PE=4 SV=1
MARRRDLMSAGEMSRAGAVVLVQRIMDGDYTSDDEVDGWLEGLDRALACPSGRVRDLIFWPPEGELSADEVVDQALAYRP
VAL