TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M4VBQ9|M4VBQ9_9DELT Uncharacterized protein OS=Bdellovibrio exovorus JSS GN=A11Q_1245 PE=4 SV=1
MHFSDRRKLIIHTVIILALAIVTVAIGAYQLDQFLALFFSRESMQTVYYYSREITEVGNSVHYFVISIVGILFTTLLYPR
ISFLRQKLSAARNEVIKYWSFFLLKALLLCGLFLHLGKFGFGRLRPHASDSFNPLSFDPLNFHHHWQSFPSGHSQVLFTA
ATTALLIWPRYRFVFLLIAAFFAFTRVTIHQHFFSDTVGGAAIGYLTTLWIYHIWPPKDLQKP