TCDB is operated by the Saier Lab Bioinformatics Group
>MBP9773791.1 hypothetical protein KBD00_04130 [Candidatus Peribacteraceae bacterium]
MNPLFYFSIFQPLYLVILPLGIFAVFIALFIPSMMASTNPKPEAISKAISCYILKSVGIGMIAFSAFPVLYMLLINELLP
LQSLLPLAFLFLIGAGTVVQSNILVQGVDDVSVSVPRAIFHHSFEVLGAIVALASGLAIVVVPLMTLNISGWEIPASTLI
LSLILMLSFSLHTAPRTRGVRMSKPVAKKKVA