TCDB is operated by the Saier Lab Bioinformatics Group
>NP_786945.1 N-terminal leader protein p48 [Norovirus GI]
MMMASKDVVPTAASSENANNNSSIKSRLLARLKGSGGATSPPNSIKITNQDMALGLIGQVPAPKATSVDVPKQQRDRPPR
TVAEVQQNLRWTERPQDQNVKTWDELDHTTKQQILDEHAEWFDAGGLGPSTLPTSHERYTHENDEGHQVKWSAREGVDLG
ISGLTTVSGPEWNMCPLPPVDQRSTTPATEPTIGDMIEFYEGHIYHYAIYIGQGKTVGVHSPQAAFSITRITIQPISAWW
RVCYVPQPKQRLTYDQLKELENEPWPYAAVTNNCFEFCCQVMCLEDTWLQRKLISSGRFYHPTQDWSRDTPEFQQDSKLE
MVRDAVLAAINGLVSRPFKDLLGKLKPLNVLNLLSNCDWTFMGVVEMVVLLLELFGIFWNPPDVSNFIASLLPDFHLQ