TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O07515|TRPP_BACSU Probable tryptophan transport protein OS=Bacillus subtilis GN=trpP PE=2 SV=1
MKTKELVIMALFAAIGAALHSIIPPFLGGMKPDMMLIMMFMGILLFPRVQNVLVIGIVTGIISALTTAFPAGQIPNIIDK
PVSAFLFFSLFLLFRKSRKTGAAAVLTVIGTILSGIVFLSSALLIVGLPGGFAALFAAVVLPAAVLNTISMIIIYPIVQT
ILRRSSFMEAAK