TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O07838 LARGE INTEGRAL MEMBRANE TRANSPORT PROTEIN - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
MSALIIFGLLIALMLTGMPISISLGLTVLTFLFTMTQVPIDTVALKLFTGIEKFEIMAIPFFILAGNFLTHGGVAKRMIN
FATAMVGHWHGGLGLAGVIACALFAAVSGSSPATVVAIGSVILPAMVNQGFPKQFGAGVITTSGALGILIPPSIVMVMYA
VATSGMVVTGPDGQPVSSASVGELFMAGVVPGLMLAGFLAFTTWNRARKFGYPRLEKASLRQRWTAFREAAWGLMLIVVV
IGGIYAGIFTPTEAAAMSAVYAFFISVFVYKDLTLRDVPRVLLSSANMSAMLLYIITNAVLFSFLMAHEGIPQALGEWMV
NAGLSWWMFLIIVNILLLAAGNFMEPSSIVLIMAPILFPVAVRLGIDPVHFGIMIVVNMEVGMCHPPVGLNLYVASGITK
MGITELTVAVWPWLLTMLAFLVLVTYVPAISLALPNLLGM