TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O07881 GLUCOSE UPTAKE PROTEIN - Staphylococcus xylosus.
MDLLIALLPALFWGSVVLINVLVGGGPYNQIRGTTFGALIIGIILLLTGNAKFDDLTIIIVGLISGAFWALGQGYQLKSV
SLIGVSKTMPISTGLQLVGTTLFSAIFLGEWSTGVQVTLGLVAMVLLVIGIALTSIKGKNEASESSKNFGKAMPILLIST
VGYVVYVVVAQIFGVDGMNALFFQSIGMAIGGLILSAKHETSVKSTLWNLIPGIVWGIGNLFMFYSQPKVGVATSFSFSQ
LLVIVSTLGGIFLLGEKKDKRQMIGIWAGIVLIVIAPLYSEILKHNYN