TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O15431|COP1_HUMAN HIGH-AFFINITY COPPER UPTAKE PROTEIN 1 (HCTR1) (COPPER TRANSPORTER 1) - Homo sapiens (Human).
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLA
MFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYL
CIAVAAGAGTGYFLFSWKKAVVVDITEHCH