TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O18280|GUR3_CAEEL Gustatory receptor family protein 3 OS=Caenorhabditis elegans OX=6239 GN=gur-3 PE=1 SV=3
MTITASNTLEFKWTSPRSSRSSFRTTTDAEQKISIDMSNTYCDQVLGPLYSYMMVLGLNHTHSSARNTMFKWPLTIYNYL
TLAILTAATIRRISQIKQKSATNEEKDAAFHVLNPTFVLTLCHALLMFSGLAAGFLLLKLQKQREKMYHVLDQGLGRNRN
EEHDSHHFKLNKLFISISFSFAAALSFVQIATKMRYLDLPDTPDLINRKIYFVILEGYVIFIASSCISLVAILFFQLCRI
LQFSIGQLIEEMVPKEKEECPLPEQSLQQIHDVQIHYQEISNAKLYIEQNFSFSLFYTYGCCIPLTCLLGYIAFRNGIQA
DMAETFSVAIWLTNTMLALMLFSIPAFMIAEEGDKLLTASFKMYHETLCEERDLLVLSQMSFLSFQMHATKLTLTAGNFF
MMNRKIMISLFSAIFTYFLILVQFDAEKERAGECNNQSRVLIVQPPV