TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O24682|O24682_SHIBO Colicin U immunity protein OS=Shigella boydii GN=cui PE=4 SV=1
MQKEHNDNKQLNNMLSWIAFAGTIPFFIILIICKLNPNLYLTNIIPDSIINIPSVISSYNPIMTKLMDIYGKSAPLLAII
TFILQFRHRKLEKGINREKLITACILTPFIYVFYAYFFLWNNFELTTSGRTVRWMSENDFTLLFFFICMYYCSFFMTYIL
CYVPVAVYKIWKER