TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O31813|YNDJ_BACSU Uncharacterized membrane protein YndJ OS=Bacillus subtilis (strain 168) GN=yndJ PE=4 SV=1
MKRNGIVSALCFIGFLAAEAPDISVAEALVLLSILFFVPGIFPFVFRQSPVRAAQFMENGLIQCYPVAAFFAVLALVTEV
GGFALIWWMYTVFNALYAILRLWETKIHRIEETSVLFGLIYLAGGGFWFFAYAAHLQIMQFGPLIILLTAVHFHYSAFLI
PIFNGLLGRTIRKHRMLYSWITWVILLSPLLIALGITYSKTLDVIAVSIYMAAIYLHAFLVFTAAFRTKTGTFLIRLSSA
VLMITIAFSMIYSFGVFRQEVTLTINQMIWIHGFVNAFGVILPALIGWRIEDAKPFDADSVKTFSRIYGKRKIGEEFLAN
IQAENNARYSGLVDDMGSLRSKDFSPEKLAPLILSFYEQTIEYNIKAKVTWSTWFRPLAIIYEWFSRRIGQIHLSTNPDW
YRMYSKIKGVHSKKDGRERVRAWIRTNEKNETIFTALYSVYRSNGEGYMNISLPLPFSSMTGILKPYHHQEKLVLTSRRR
KSRAGDEGIYLQTRAGTCPLPLSETFLIEAVHDNKLTAVHHMWLFGIKFLTVHYSITHINQPIERT