TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O50649 TnaT protein - Symbiobacterium thermophilum.
MEAQRDQWKSRSGFIFATIGAAVGLGNFWRFPFMAYQNGGGAFLLPYFVALLTAGVPLMILEFGFGHKMRTATITAFKKL
NRRFEWIGWWQITVPVVVVTFYSVIISWSLRYLIFSFTQAWGDDPGTFFSSDFLGITSGPLELGGLRWGIFAAVAVVWFA
NYYISAQGISGGIEKACKIMTPFLIVAMLIFVIRGITLPGATYGLNYFLNPDFSKIMDPGVWVAAYSQVFFSTTLAVGVM
IAYASYVPEDSDLANNAFITVFANSSFDFMAGLAVFSTLGYAAVTAGVPFEEMAVAGPGVAFVAFPKAISMLPGPTWLQS
LFGILFFSALLLAGISSSISQMESFASAVIDRFGVDRKKLLGWFSLIGFAFSALFATGAGVHILDIVDHFVGSYAIAILG
LVEAIVLGYIMGTARIREHVNLTSDIRVGMWWDVLVKYVTPVLLGYNILSNFISEFREPYAGYPTGALVLFGWVVAIAMF
GTSLFMQWRSQQLDVTGGEVG