TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O68827|RARD_PSEAE Chloramphenicol-sensitive protein rarD - Pseudomonas aeruginosa.
MRISGQGVLLSLAASVLFVTLPGYVHLLEPLDSLQVVAHRVVWSIPMVFLLVVATRQWPTLRAAWCRLFAEPWLLACFPL
TAAMMLLQWGIFIWAPLAGKTLELSLGYFLLPLAMVLVGRVFYGERLTPLQAIAVACALAGVLHEFWLTRAFSWVSLVTA
LGYPPYFMLRRRMGVDALSGFVFEMLFLLPLALAALYWLGDESQAFREAPRLWLLLPMLGLISALAFGAMMASSRLLPMG
LFGILSYVEPVLLFLVAVLFLGEAFRPEQLWTYAPIWLAVLLTGWDSARLLRKQARRGI