TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O75015|FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAAT
VNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIP
KATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI