TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGV
NFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQR
LTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV