TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O76188 Potassium coupled amino acid transporter - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm).
MNDGQVNGGFESSEPKMEPKRSSQISLPPANLKATMDNIDDMDLEAEPPERMVWSNNIEFLMSCIATSVGLGNVWRFPFI
AYQNGGGAFLVPYIIVLLLVGKPVYYLECVLGQFSSRNSVKIWSISPAMKGTGYAQAVGCGYILSYYVVICGLCLFYLAM
SFQATLPWAICQPEWENCVPSDPTLAAGVGNITNGTSSAELYFLRTVLQQSDGIEGGLGAPIWYLVLCLFIAWLMVFGVV
ARGVKSSGKAAYFLALFPYVVMITLFITTVLLPGATDGILFFVTPDWWKLLELGVWYAAITQVFFSLSVCTGAIIMFSSY
NGFKQNVYRDALIVTTLDTFTSFLSGCTIFGILGNLAYELNSDVGDVIGSGGTSLAFISYPDAIAKTFQPQLFSVLFFLM
MSVLGIGSSVALLSTLNTVVMDAFPRVPTVYMSALSCTCGFLLGLVYCTPGGQFILELVDHYGGTFLVLFCAISELAGVF
WIYGLENLCLDIEFMMGKTTGFYWRLCWGIVTPGMMIIVFIYALLSFENLVFGDFYVYPVAGYVAGYMMLFLGIVLVPIG
IVVTLYKYRTGNFRETVKKAFHSKPSWGPRSPRLRREWMQFRIEAKALRQKMNTSRVKHLWYSITGAYRRNINK