TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O76687|O76687_CAEEL Uncharacterized protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M01G5.3 PE=1 SV=2
MATEKLDSEWKLVQDDFQKLEKIHDEYIQKSRQVSKFQETAGKAMKHHNYLLKNLKETMRQAQQSAEKLDEADTSKTDVL
SHVAKLREELAVANLRIRDMQGELPAQTNGFYLNLILGSNLNVSLLTKAEKFKYKQEYEGFKWSITILICLLALCAWIWP
FRVFDSILCFLMVWYYCTLTIRESVLRVNGSKIKGWWLSHHYLSCAVPGIVLTWKDGLCYQEFRPYFLIFTFYISLVQLA
QNQYQSGCLRRLHSLGQGHQMDITVEGFTSWQFKGLTFLLPFLAFGYLYQLYLAWKLFGYTNSETCDGIWQVWTLSLLLG
LIAGGNIVTTSMVCIRKFKTSTSYTNIVTLTRKYSSRNRIREAPPTEPLLRGAPPPPTGKLHLH