TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O80565|OEP37_ARATH Outer envelope pore protein 37, chloroplastic OS=Arabidopsis thaliana GN=OEP37 PE=1 SV=2
MADPSSQNPNLATPPPPSSPSPTHQIQSGTSELSPPSRPPCSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNL
AKLKLSFQNNSQREISQPQVSFTSKHVSVLYDVEEKNTFIKSTLDVHPRLQLRALHNVKAQQGEVAMEANLTEPGYSLEL
SSPVPIGYPRATLKFPLGEISLQEKDEEEEEKQKRTLSVNGILKRQVMNGVCTALYTDEELRLRYAYKDDALSFIPSISL
PSNAASFAFKRRFSPSDKLSYWYNFDSNMWSAVYKRTYGKDYKLKAGYDSDVRLGWASLWVGDEAGKVKTTPMKMKVQFM
LQVPQDDIKSSVLMFRVKKRWDI