TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O80638|WTR14_ARATH WAT1-related protein At2g39510 OS=Arabidopsis thaliana OX=3702 GN=At2g39510 PE=2 SV=1
MALKTWKPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLASYRHIVATIFIAPFAYFLDRKIRPKMTLSIFFKILLLGLL
EPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNVKKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPW
ANPHDIHQDSSNTGVKQDLTKGASLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFLGSIESTIVALFIERGNPSAW
AIHLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIVIVLGLYSVL
WGKSKDEPSSSFSDMDKELPLSTPQIVLPSKANAKMDTNDASVVISRPNTNESV