TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O81514|GPTP1_ARATH Glucose-6-phosphate/phosphate-translocator-like protein 1 OS=Arabidopsis thaliana GN=At4g03950 PE=2 SV=2
MISSIKPVLPSLTAIVGIGIYFAIWWALNGVFNNYNKKVLNAFPYLWLTLTLSLACGSLMMLVSWVALAHTIGHVEAIVS
MSKVVVSFTHTSSKAVRQPLASLSQASSWARCALAAVMELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSVMNYYA
CLSMMSLLIVTPFANSVEGPQMWADGWQNDVSKSDQTLSSKWVVAHSVFYHLYNQVSYIPRCLNHHLPNPLKHVNALGAA
IAILGTFIYSQIKNRVKKNHILLVLCLGMLEPLVITL