TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O81775|O81775_ARATH Putative uncharacterized protein F28M20.80 OS=Arabidopsis thaliana GN=AT4g31730 PE=2 SV=1
MRPLSVQSKFEDVATSTSVNHHGVTPQSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSSSGEEDGQNVDEEKESR
SGDKAANGAYEEKFLVIMAGEDLPRYLATPAMKKCTCGGHEGKMVISQEESVAKEEEKMREGEEEKVKDTGETTTTSH