TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O87672|O87672_AERHY 12.5 kDa polypeptide OS=Aeromonas hydrophila PE=4 SV=1
MSLRYYIKNILFGLYCTLIYIYLITKNSEEYYFLVTDKMLYAIVISTILCPYSKYAIEHIAFNFIKKDFFERRKNLNNAP
RSKINLFMLYNLFVLVLAIPFWT