TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O95833|CLIC3_HUMAN Chloride intracellular channel protein 3 OS=Homo sapiens GN=CLIC3 PE=1 SV=2
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIED
FLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESR
RRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR