TCDB is operated by the Saier Lab Bioinformatics Group
>OAP09968.1 hypothetical protein AXX17_AT2G35750 [Arabidopsis thaliana]
MEIPRRTFVFFFSLCLLSSTSLSIDNFHQAFPIVEPAPGHTKLQLSREGLEAISRITTPISAVAVIGPYRSGKSFLLNQL
LSLSCYEGFGVGHMRDTKTKGIWVWGTPLELEIDGVKTSVIYLDTEGFESVGKSNVYDDRIFALATVMSSVLIYNLPETI
READISRLSFAVELAEEFYGRVKGEDVAFEPSKLLWLIQRDFLQGKSVKQMVDEALRHVPNEDGNKNIDQVNQIRDSLAI
MGDNSTAFSLPQPHLMRTKLCDLKDEDLDSTYVARRDQLKKLVASIIRPKIVQGKTLNGKEFISFLEQILDALNKGEIPS
TGSLVEVFNKDIVERCVKLYNEKMVRVRLPMSEESLQSAHEMAHNEAIKAFDAQHFGRQHAKKSVDQLDEQMQEVYKNFV
LANEYQSSKLCEALYTSCEDDMDHLQALRLPSMAKFNAGFVYCNKTFEQQCVGPSKQNYEQRLTKMMGKSRSLFIKEYNN
RLFNWLVGFSLVMVVVGRFIIKFILLEMAAWILFIFLETYTRMFWTAEALYYNPVWHFIVGTWENVVYSPILDLDRWAIP
IVCIIALCVLYWRCYGKRKHGARWLLPLYNNQKNGRNRERSE