TCDB is operated by the Saier Lab Bioinformatics Group
>OGL33749.1 hypothetical protein A3E20_03270 [Candidatus Saccharibacteria bacterium RIFCSPHIGHO2_12_FULL_47_16]
MTIVLYVICMIAFLKLIFISSISVDGTKQSRFELSRLAKKGESASQSILEREVLLRDLLSVQRALVAVLIVIIVASAIAA
CGWPIGLLLSVVVALEFGAIARLPVIRRNSQRVYEKYEAKLLEFMKRHPRLFSILRSVTHEGPRNFTIGSRDELRHLIDQ
ADGHILTSREKERLLAGLVLESMTVFEYMTKRDQMTTIESSELLGPLVLDDLHKSGQRLFPVTQKSQIVGVLDIGDTTDL
STSKRSLTAEKAMSSTLFYIQQDQSVLSALETFARTGSQLLFVIDTDESIVGMIALETCLPLAIGDLQTDDFTADDDRTA
VAARLV