TCDB is operated by the Saier Lab Bioinformatics Group
>OGY45638.1 hypothetical protein A2744_03045 [Candidatus Buchananbacteria bacterium RIFCSPHIGHO2_01_FULL_44_11]
MATTTLATTTLMDLVNSFSDKTADLADQVTAQAQAGGSDIWFTFLGLDWSKPTWDLVILLFFVISVLIYSFTLGRDRIVA
ILISTYLSLAVATNLPYADKLNELISRTGGFAFQTAAFLAAFILLFVFLSRSSLIQSLSNLGGSFWQVILFSLLQVGLLT
SVILSFLPPAALDQLSFFTKIVFLSELGRFCWVVLPILALVFVRGRQLT