TCDB is operated by the Saier Lab Bioinformatics Group
>OLQ15270.1 P2X receptor E [Symbiodinium microadriaticum]
MDLQHLRRIGLPTVGEGHETTETCERRPEIFNRRVLAVMPTHSEFDEEAVAAAAAGLPVARFTLTNEVTLAGLPEKGPGD
PFVGIFRGFMLSKQRRQFLHDKLRGLGVELLVTPAEYAAAHLFPATFAALRPLSPRAAWVSVDPNRVQPANFAEVVQSVS
GWGCPYVLLKDFVKSAKAHGQRFMKVPVDGDLSELACDFVAARGSQFNEGVVFKEYVDLVRYPARGEPTTNEWRLWLRDP
TMDSPRRNFVHGRASKFMQGLLVEASPNSFQLAFLDQCRLPGGASIRFLMPLLSDCSFSAPKYAVIRDYRLGCLHYSFML
LIFFYVIIYQVLYKCGYLEMPDVGISMVSSLRYPDVTIDSRNVPYCSQGDSCTGKAEEKCPCRRFRPEELLRQNQDTINL
VTSVAYIDNSGDVARVEYVPDVENYELLLEPTVYQRHHMPGMANEVVQGYQIQGRLFVGSRGEAPNHIHHQLCKEKSKVK
DGAWAHPEGQNTSQAPCYISSDANVLGNDVFKVSTLLGSMGVSLDDMRGVAVFSGENRTLRRSGFTALLSLEVRNYAYWR
GLVDTYYVLDFEMAGRNKHHFSQYATVKRGDRVELAHEYSINVVIAPSGTIAALSRQSFLDVMTNSLGLLTVSTMVVKIL
ASWCCGSLSRVYDKVMKSTTPDGRFMEDVSRRVEHDKAKHKDEETPSPRKEFKELSLRKEFEERFGYEAEDDVELILKMG
RIHEKEESQHSAPVSPRSGENGDDRDDETTMTQVAWDLEDQAAGELNEVAAFEYSGAKRIKFQKQLLKAFIALGRLLLLE
QFHPYCGDAAVPPSEALLAEVAKMAKCIPNPYITIDVAEVGSSWKLATEAFRDLLLARIFGTIGSFLRLTLARHGDKMEL
RCFLAKALIEKEQPAFDMTALKANLRPSPQRKIYPVDFIAAVGSMATSDCLCLPLQKVLEPFAPGVHTTISYASTDGEYK
DDGKRKCFVVNGRYRCHNLEAHGFALMRVPLEKTQGHDLYNYLVASKVLYPLAEDVLRRAFPTSTKVLVFDHIARNDARY
AQEAKAGEITKMLASSYAFHVHGDYTVRSGFSRARSLLEPHEDSGRIEAAIQQRFAFVNVWVPLKKVERDPLGMIEWGSQ
RPQDVVSIKFIYPHRTGEIYRVLPSDHHRWVYYPDMMPGECLIFKVFDSATDGRSRFSLHAAFPDPNCEPDAPSRESIEM
RCVVFFGDLPKDFASSFVAPHLLPGTDCCAMSCILNPGKGILHAFLHEAVLILSVGAFPDASIECDKKSPI