TCDB is operated by the Saier Lab Bioinformatics Group
>ORZ36391.1 hypothetical protein BCR44DRAFT_157246 [Catenaria anguillulae PL171]
MGYDLDDLFCYDTFKIVRVRDRRLGIPYYLFMICTAAYIIYSIATDQLYLRKEDVTNGSVRITIQPPAAGVTTPAYCGRS
PAGSCLFFDATQVVPASTDENGGGGMFITTRITLTNATVPANGCDIQAPSSAGCMVSAPKENGITYFVADIENFTARINP
PKHTVRGKSNAIASRSEDMVGVVKDTAGKSKRVYVPTLMSDTNLNIVIRDELGGDTSRLHIRGAPAPGDVMTVKDLLAVA
NVTSLDMLSESPTARSDETIRESGFVLLLTIEYGNRVENSSALGYTYSATYIKGTEAKVAETVYVGPSGGPTGVQVRNRH
GIRLAVVQKGQLGSFDFMALLTSIVASVALLRVSVLVVEFMLVWVMPEKSVYRQYKIETTADFSDLRDEERAKSLPRPAM
ADHRWQVLTGAKPAVLPAVHRQQHQPRTHPVLSSEMTVKQSIAFHGDDADNEPRDKRA