TCDB is operated by the Saier Lab Bioinformatics Group
>OXB76276.1 hypothetical protein H355_014684 [Colinus virginianus]
MEMCGVVVSSVFAVVLVLKLGLTPIMAQREEQQTGVAGKEVILSCKIINHQKDVTCTWKYKYKEVSSTILRFSRAQVLKG
KAPMIHRSELNLSSKQLKVSDLNLDDAGIYICECHPHAVSISLQVFKYSGTWTCHIHSDSPSINQNISFDVKVLGFGKEH
MEAVYTTVGNTVILSWYLNFRGIAWKEGFTGKLNWEPQGNRIIHELLDFNVTTHRELHETKKSNHIWFEIPEKKARSTIE
VKIPKVQLNHSGQYQCQLEINSRRMKSMRALVVMQVSADPAGPLSRGGKMSLLCQVSGPLPSNAHLLWERVNGTQLETKK
SKQREAKVEVSVSAPGLWNCHLMEDNNIKISLNYTVEEAHVWNSYAVIGAIIGASVLLIGLVCLCIIMETSKKDGTSKTV
LAGKEDMSVSTPDV