TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P00854|ATP6_YEAST ATP synthase A chain precursor (EC 3.6.1.34) (Protein 6) - Saccharomyces cerevisiae (Baker's yeast).
MFNLLNTYITSPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIM
NMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGT
PLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQ
GYVWAILTASYLKDAVYLH