TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P02984|IMM3_ECOLX Colicin-E3 immunity protein OS=Escherichia coli GN=imm PE=1 SV=3
MGLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDY
RDGDW