TCDB is operated by the Saier Lab Bioinformatics Group
>P03493|BM2_INBLE Matrix protein 2 - Influenza B virus (strain B/Lee/1940).
MLEPLQILSICSFILSALHFMAWTIGHLNQIKRGVNLKIQIRNPNKEAINREVSILRHNYQKEIQAKETMKKILSDNMEV
LGDHIVVEGLSTDEIIKMGETVLEVEELQ