TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05919|VPU_HV1H2 VPU protein (U ORF protein) - Human immunodeficiency virus type 1 (HXB2 isolate) (HIV-1).
QPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDVDD
L