TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P06629|YWJG_BACSU Uncharacterized protein YwjG OS=Bacillus subtilis (strain 168) OX=224308 GN=ywjG PE=4 SV=1
MLKIFTTQLTGIFSRIQDKESDAIEDGARLLAQAVISGHSIYLYGANELQGVFYEATESKEPFPSVKAFPENAEEVTESD
RVLMFCSGTGTAEEQELAKELYEKGAGVVCVSPAAKDSAGIEQYCDVHIDSKLKMPLVPDEDGTRYGFPSLMTALYVYHA
LSFTLKEILQEYA