TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P07577|SH_PIV5 Small hydrophobic protein OS=Parainfluenza virus 5 (strain W3) GN=SH PE=3 SV=1
MLPDPEDPESKKATRRAGNLIICFLFIFFLFVTFIVPTLRHLLS