TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P08550|CVPA_ECOLI Colicin V production protein OS=Escherichia coli (strain K12) GN=cvpA PE=1 SV=1
MVWIDYAIIAVIAFSSLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIV
NFVIGQLVEKTGLSGTDRVLGVCFGALRGVLIVAAILFFLDSFTGVSKSEDWSKSQLIPQFSFIIRCFFDYLQSSSSFLP
RA