TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P08637|FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAAT
VDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIP
KATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
KDHKFKWRKDPQDK