TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P09132|SR19_HUMAN Signal recognition particle 19 kDa protein (SRP19) - Homo sapiens (Human).
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRG
RVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK